Comparison

Recombinant Human Neuroglobin(NGB)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015776HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALE PDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVML VIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSS FSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAV VQAMSRGWDGE
Research Topic
Transport
Uniprot ID
Q9NPG2
Gene Names
NGB
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-151aa
MW of Fusion Proten
32, 9
Sequence Info
Full Length
Relevance
Involved in oxygen transport in the brain. Hexacoordinate globin, displaying competitive binding of oxygen or the distal His residue to the iron atom. Not capable of penetrating cell mbranes. The deoxygenated form exhibits nitrite reductase activity inhibiting cellular respiration via NO-binding to cytochrome c oxidase. Involved in neuroprotection during oxidative stress. May exert its anti-apoptotic activity by acting to reset the trigger level of mitochondrial cytochrome c release necessary to commit the cells to apoptosis.
Reference
14-3-3 binding and phosphorylation of neuroglobin during hypoxia modulate six-to-five heme pocket coordination and rate of nitrite reduction to nitric oxide.Jayaraman T., Tejero J., Chen B.B., Blood A.B., Frizzell S., Shapiro C., Tiso M., Hood B.L., Wang X., Zhao X., Conrads T.P., Mallampalli R.K., Gladwin M.T.J. Biol. Chem. 286:42679-42689(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close