Comparison

Recombinant Mouse Nidogen-1(Nid1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015802MO-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Entactin
AA Sequence
SPQRVNGKVKGRIFVGSSQVPVVFENTDLHSYVVM NHGRSYTAISTIPETVGYSLLPLAPIGGIIGWMFA VEQDGFKNGFSITGGEFTRQAEVTFLGHPGKLVLK QQFSGIDEHGHLTISTELEGRVPQIPYGASVHIEP YTELYHYSSSVITSSSTREYTVMEPDQDGAAPSHT HIYQWRQTITFQECAHDDARPALPSTQQLSVDSVF VLYNKEERILRYALSNSIGPVRDGSPDA
Research Topic
Others
Uniprot ID
P10493
Gene Names
Nid1
Tag Info
N-terminal 6xHis-tagged
Expression Region
428-665aa
MW of Fusion Proten
30, 3
Sequence Info
Partial
Relevance
Sulfated glycoprotein widely distributed in basent mbranes and tightly associated with laminin. Also binds to collagen IV and perlecan. It probably has a role in cell-Extracellular domain matrix interactions.
Reference
Identification of the basement membrane protein nidogen as a candidate ligand for tumor endothelial marker 7 in vitro and in vivo.Lee H.K., Seo I.A., Park H.K., Park H.T.FEBS Lett. 580:2253-2257(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Mus musculus (Mouse)
Amount: 100ug
Available: In stock
Listprice: €495.78
Price: €495.78
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close