Comparison

Recombinant Mouse Homeobox protein Nkx-2.2(Nkx2-2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP015842MO-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Homeobox protein NK-2 homolog B
AA Sequence
MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEE SEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSD NPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPE PSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQT YELERRFRQQRYLSAPEREHLASLIRLTPTQVKIW FQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVR DGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHM QYNAQYSSASTPQYPTAHPLVQAQQWTW
Research Topic
Others
Uniprot ID
P42586
Gene Names
Nkx2-2
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-273aa
MW of Fusion Proten
46, 1
Sequence Info
Full Length
Relevance
Acts as a transcriptional activator. Required for the maintenance of NEUROD1 expression in the horomone-producing endocrine cells of the pancreas. May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Associates with chromatin at the NEUROD1 promoter region. Binds to a subset of consensus elements within the NEUROD1 promoter.
Reference
"Regional expression of the homeobox gene Nkx-2.2 in the developing mammalian forebrain."Price M., Lazzaro D., Pohl T., Mattei M.-G., Ruether U., Olivo J.-C., Duboule D., di Lauro R.Neuron 8:241-255(1992)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Mus musculus (Mouse)
Amount: 200ug
Available: In stock
Listprice: €780.22
Price: €780.22
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close