Comparison

Recombinant Human Homeobox protein Nkx-3.2(Nkx3-2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Lyophilized Powder
Amount 10ug
Host E.coli
Item no. CSB-EP015849HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Bagpipe homeobox protein homolog 1
Homeobox protein NK-3 homolog B
AA Sequence
MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPA PGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSL LASPARTRTAVGQSAESPGGWDSDSALSEENEGRR RCADVPGASGTGRARVTLGLDQPGCELHAAKDLEE EAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVP GLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSR AAFSHAQVFELERRFNHQRYLSGPERADLAASLKL TETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKV AVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPY YCLPGWALSTCAAAAGTQ
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P97503
Gene Names
Nkx3-2
Tag Info
N-terminal 10xHis-SUMO-tagged
Expression Region
1-333aa
MW of Fusion Proten
53, 7
Sequence Info
Full Length
Relevance
Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.
Reference
"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: Out of stock
Listprice: €108.63
Price: €108.63
nicht lieferbar

Fragen Sie nach einem alternativen Produkt

Questions about this Product?
 
Close