Comparison

Recombinant Human Nicotinamide N-methyltransferase(NNMT)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP015906HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAES QILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQ LLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAF DWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLK CDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPT YCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQK FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSST MANNEGLFSLVARKLSRPL
Research Topic
Signal Transduction
Uniprot ID
P40261
Gene Names
NNMT
Tag Info
N-terminal GST-tagged
Expression Region
1-264aa
MW of Fusion Proten
56, 6
Sequence Info
Full Length
Relevance
Catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for biotransformation of many drugs and xenobiotic compounds.
Reference
"Human liver nicotinamide N-methyltransferase. cDNA cloning, expression, and biochemical characterization."
Aksoy S., Szumlanski C.L., Weinshilboum R.M.
J. Biol. Chem. 269:14835-14840(1994)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close