« Back
Home /
Recombinant Human Nicotinamide N-methyltransferase(NNMT)

Recombinant Human Nicotinamide N-methyltransferase(NNMT)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	500ug
Host	E.coli
Item no.	CSB-EP015906HU-500
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Signal Transduction
Uniprot ID	P40261
Gene Names	NNMT
Organism	Homo sapiens (Human)
AA Sequence	MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAES QILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQ LLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAF DWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLK CDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPT YCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQK FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSST MANNEGLFSLVARKLSRPL
Expression Region	1-264aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	56.6 kDa
Relevance	Catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for biotransformation of many drugs and xenobiotic compounds.
Reference	"Human liver nicotinamide N-methyltransferase. cDNA cloning, expression, and biochemical characterization." Aksoy S., Szumlanski C.L., Weinshilboum R.M. J. Biol. Chem. 269:14835-14840(1994)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for biotransformation of many drugs and xenobiotic compounds.
Subcellular Location	Cytoplasm
Protein Families	Class I-like SAM-binding methyltransferase superfamily, NNMT/PNMT/TEMT family
Tissue Specificity	Predominantly expressed in the liver. A lower expression is seen in the kidney, lung, skeletal muscle, placenta and heart. Not detected in the brain or pancreas.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP015906HU-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time