Comparison

Recombinant Human Nicotinamide N-methyltransferase(NNMT)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP015906HU-500
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P40261
Gene Names
NNMT
Organism
Homo sapiens (Human)
AA Sequence
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAES QILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQ LLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAF DWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLK CDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPT YCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQK FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSST MANNEGLFSLVARKLSRPL
Expression Region
1-264aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
56.6 kDa
Relevance
Catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for biotransformation of many drugs and xenobiotic compounds.
Reference
"Human liver nicotinamide N-methyltransferase. cDNA cloning, expression, and biochemical characterization."
Aksoy S., Szumlanski C.L., Weinshilboum R.M.
J. Biol. Chem. 269:14835-14840(1994)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for biotransformation of many drugs and xenobiotic compounds.
Subcellular Location
Cytoplasm
Protein Families
Class I-like SAM-binding methyltransferase superfamily, NNMT/PNMT/TEMT family
Tissue Specificity
Predominantly expressed in the liver. A lower expression is seen in the kidney, lung, skeletal muscle, placenta and heart. Not detected in the brain or pancreas.
Amount: 500ug
Available: In stock
Listprice: €1,013.82
Price: €1,013.82
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close