Comparison

Recombinant Human Nucleolar protein 3(NOL3)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015921HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Apoptosis repressor with CARD1
AA Sequence
MGNAQERPSETIDRERKRLVETLQADSGLLLDALL ARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGE AACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSY DPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPE GSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPEL EPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
Research Topic
Apoptosis
Uniprot ID
O60936
Gene Names
NOL3
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-208aa
MW of Fusion Proten
38, 6
Sequence Info
Full Length of Isoform 2
Relevance
Isoform 1: May be involved in RNA splicing.
Reference
Screening of mutations in NOL3 in a myoclonic syndromes series.Macerollo A., Mencacci N.E., Erro R., Cordivari C., Edwards M.J., Wood N.W., Bhatia K.P.J. Neurol. 261:1830-1831(2014)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close