Comparison

Recombinant Human Nucleolar protein 3(NOL3)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015921HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Apoptosis
Uniprot ID
O60936
Gene Names
NOL3
Organism
Homo sapiens (Human)
AA Sequence
MGNAQERPSETIDRERKRLVETLQADSGLLLDALL ARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGE AACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSY DPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPE GSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPEL EPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
Expression Region
1-208aa
Sequence Info
Full Length of Isoform 2
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
38.6 kDa
Alternative Name
Apoptosis repressor with CARD1
Relevance
Isoform 1: May be involved in RNA splicing.
Reference
Screening of mutations in NOL3 in a myoclonic syndromes series.Macerollo A., Mencacci N.E., Erro R., Cordivari C., Edwards M.J., Wood N.W., Bhatia K.P.J. Neurol. 261:1830-1831(2014)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Isoform 1
Involvement in disease
Myoclonus, familial cortical (FCM)
Subcellular Location
Isoform 1: Nucleus, nucleolus, Note=The SR-rich C-terminus mediates nuclear localization, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, Mitochondrion, Sarcoplasmic reticulum, Membrane, Lipid-anchor
Tissue Specificity
Highly expressed in heart and skeletal muscle. Detected at low levels in placenta, liver, kidney and pancreas.
Amount: 100ug
Available: In stock
Listprice: €405.35
Price: €405.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close