« Back
Home /
Recombinant Rat NADPH oxidase 4(Nox4),partial

Recombinant Rat NADPH oxidase 4(Nox4),partial

Manufacturer	Cusabio
Category	Oncology Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	1mg
Host	E.coli
Item no.	CSB-EP015961RA-1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Cardiovascular
Uniprot ID	Q924V1
Gene Names	Nox4
Organism	Rattus norvegicus (Rat)
AA Sequence	GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVS EHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAH FPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISV INHPSDVMELRMIKENFKARPGQYIILHCPSVSAL ENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDL LLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEE SLNYE
Expression Region	210-424aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-B2M-tagged
MW	38.6 kDa
Alternative Name(s)	Kidney oxidase-1
Relevance	Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB.
Reference	Direct interaction of the novel Nox proteins with p22phox is required for the formation of a functionally active NADPH oxidase. Ambasta R.K., Kumar P., Griendling K.K., Schmidt H.H.H.W., Busse R., Brandes R.P. J. Biol. Chem. 279:45935-45941(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB.
Subcellular Location	Endoplasmic reticulum membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein, Cell junction, focal adhesion
Tissue Specificity	Expressed in vascular smooth muscle.
Tag Information	N-terminal 6xHis-B2M-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time