Comparison

Recombinant Rat NADPH oxidase 4(Nox4),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP015961RA-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Kidney oxidase-1
AA Sequence
GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVS EHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAH FPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISV INHPSDVMELRMIKENFKARPGQYIILHCPSVSAL ENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDL LLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEE SLNYE
Research Topic
Cardiovascular
Uniprot ID
Q924V1
Gene Names
Nox4
Tag Info
N-terminal 6xHis-B2M-tagged
Expression Region
210-424aa
MW of Fusion Proten
38, 6
Sequence Info
Extracellular Domain
Relevance
Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB.
Reference
"Direct interaction of the novel Nox proteins with p22phox is required for the formation of a functionally active NADPH oxidase."
Ambasta R.K., Kumar P., Griendling K.K., Schmidt H.H.H.W., Busse R., Brandes R.P.
J. Biol. Chem. 279:45935-45941(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Rattus norvegicus (Rat)
Amount: 200ug
Available: In stock
Listprice: €968.79
Price: €968.79
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close