Recombinant Human Atrial natriuretic peptide receptor 2(NPR2),partial

Cardiovascular

Not Test

Homo sapiens (Human)

RNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALG RALPVDLRFVSSELEGACSEYLAPLSAVDLKLYHD PDLLLGPGCVYPAASVARFASHWRLPLLTAGAVAS GFSAKNDHYRTLVRTGPSAPKLGEFVVTLHGHFNW TARAALLYLDARTDDRPHYFTIEGVFEALQGSNLS VQHQVYAREPGGPEQATHFIRANGRIVYICGPLEM LHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPT RATGRPWQDNRTREQAQALREAFQTVLVITYREPP NPEYQEFQNRLLIRAREDFGVELGPSLMNLIAGCF YDGILLYAEVLNETIQEGGTREDGLRIVEKMQGRR YHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQP AAHYSGAEKQIWWTGRPIPWVKGAPPSDNPPCAFD LDDPSCDKTPLSTLAI

23-458aa

64.5 kDa

Atrial natriuretic peptide receptor type B ; ANP-B ; ANPR-B ; NPR-BGuanylate cyclase B ; GC-B

DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)

Liquid or Lyophilized powder

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.

Acromesomelic dysplasia, Maroteaux type (AMDM); Epiphyseal chondrodysplasia, Miura type (ECDM); Short stature with non-specific skeletal abnormalities (SNSK)

Adenylyl cyclase class-4/guanylyl cyclase family

N-terminal 6xHis-SUMO-tagged