Comparison

Recombinant Mouse Nuclear respiratory factor 1(Nrf1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP016076MO-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q9WU00
Gene Names
Nrf1
Organism
Mus musculus (Mouse)
AA Sequence
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEH SMLSADEDSPSSPEDTSYDDSDILNSTAADEVTAH LAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRK RQQTRLLRKLRATLDEYTTRVGQQAIVLCISPSKP NPVFKVFGAAPLENVVRKYKSMILEDLESALAEHA PAPQEVNSELPPLTIDGIPVSVDKMTQAQLRAFIP EMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRS DVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLY AFEDQQTQTQATTTHSIAHLVPSQTVVQTFSNPDG TVSLIQVGTGATVATLADASELPTTVTVAQVNYSA VADGEVEQNWATLQGGEMTIQTTQASEATQAVASL AEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE ATLQGGGQIVLSGETAAAVGALTGVQDANGLVQIP VSMYQTVVTSLAQGNGPVQVAMAPVTTRISDSAVT MDGQAVEVVTLEQ
Expression Region
1-503aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
69.6 kDa
Alternative Name
Nuclear respiratory factor 1
Short name:
NRF-1
Alternative name(s):
Alpha palindromic-binding protein
Short name:
Alpha-pal
Relevance
Transcription factor that activates the expression of the EIF2S1 (EIF2-alpha) gene. Links the transcriptional modulation of key metabolic genes to cellular growth and development. Implicated in the control of nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication
Reference
"Coding sequence, chromosomal localization, and expression pattern of Nrf1: the mouse homolog of Drosophila erect wing."Schaefer L., Engman H., Miller J.B.Mamm. Genome 11:104-110(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Transcription factor that activates the expression of the EIF2S1 (EIF2-alpha) gene. Links the transcriptional modulation of key metabolic genes to cellular growth and development. Implicated in the control of nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication (By similarity).
Subcellular Location
Nucleus
Protein Families
NRF1/Ewg family
Tissue Specificity
Widely expressed in embryonic, fetal, and adult tissues.
Amount: 1mg
Available: In stock
Listprice: €2,191.83
Price: €2,191.83
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close