Comparison

Recombinant Human Pro-neuregulin-2, membrane-bound isoform(NRG2),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP016078HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Divergent of neuregulin-1 ; DON-1Neural- and thymus-derived activator for ERBB kinases ; NTAK
AA Sequence
CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSS NSTREPPASGRVALVKVLDKWPLRSGGLQREQVIS VGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDT NGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGE KQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIK YGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDT VRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNG GVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYM PDPKQKAEELYQKR
Research Topic
Neuroscience
Uniprot ID
O14511
Gene Names
NRG2
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
112-405aa
MW of Fusion Proten
48, 8
Sequence Info
Extracellular Domain
Relevance
Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.
Reference
Ligand discrimination in signaling through an ErbB4 receptor homodimer.Sweeney C., Lai C., Riese D.J. II, Diamonti A.J., Cantley L.C., Carraway K.L. IIIJ. Biol. Chem. 275:19803-19807(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close