« Back
Home /
Recombinant Human Pro-neuregulin-3, membrane-bound isoform(NRG3),partial

Recombinant Human Pro-neuregulin-3, membrane-bound isoform(NRG3),partial

Manufacturer	Cusabio
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Colorectal Cancer Breast Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	E.coli
Item no.	CSB-EP016079HU-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Cancer
Uniprot ID	P56975
Gene Names	NRG3
Organism	Homo sapiens (Human)
AA Sequence	MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAAG GGPDGGGEGAAEPPRELRCSDCIVWNRQQTWLCVV PLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDS KGMGQDPFFLSKPSSFPKAMETTTTTTSTTSPATP SAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPI RASPRSTTARNTAAPATVPSTTAPFFSSSTLGSRP PVPGTPSTQAMPSWPTAAYATSSYLHDSTPSWTLS PFQDAASSSSSSSSSATTTTPETSTSPKFHTTTYS TERSEHFKPCRDKDLAYCLNDGECFVIETLTGSHK HCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEF MESEEVYQRQ
Expression Region	1-360aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	53.8 kDa
Alternative Name(s)	Pro-NRG3
Relevance	Direct ligand for the ERBB4 tyrosine kinase receptor. Binding results in ligand-stimulated tyrosine phosphorylation and activation of the receptor. Does not bind to the EGF receptor, ERBB2 or ERBB3 receptors. May be a survival factor for oligodendrocytes
Reference	"Neuregulin-3 (NRG3): a novel neural tissue-enriched protein that binds and activates ErbB4."Zhang D., Sliwkowski M.X., Mark M., Frantz G., Akita R., Sun Y., Hillan K., Crowley C., Brush J., Godowski P.J.Proc. Natl. Acad. Sci. U.S.A. 94:9562-9567(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Direct ligand for the ERBB4 tyrosine kinase receptor. Binding results in ligand-stimulated tyrosine phosphorylation and activation of the receptor. Does not bind to the EGF receptor, ERBB2 or ERBB3 receptors. May be a survival factor for oligodendrocytes.
Subcellular Location	Pro-neuregulin-3, membrane-bound isoform: Cell membrane, Single-pass type I membrane protein, Note=Does not seem to be active, SUBCELLULAR LOCATION: Neuregulin-3: Secreted, SUBCELLULAR LOCATION: Isoform 3: Cell membrane, Single-pass type I membrane protein
Protein Families	Neuregulin family
Tissue Specificity	Highly expressed in most regions of the brain with the exception of corpus callosum. Expressed at lower level in testis. Not detected in heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, ovary, small intestine, colon and peripheral blood leukocytes.
Paythway	ErbBsignalingpathway
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP016079HU-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time