Comparison

Recombinant Human Pro-neuregulin-3, membrane-bound isoform(NRG3),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP016079HU-500
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Cancer
Uniprot ID
P56975
Gene Names
NRG3
Organism
Homo sapiens (Human)
AA Sequence
MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAAG GGPDGGGEGAAEPPRELRCSDCIVWNRQQTWLCVV PLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDS KGMGQDPFFLSKPSSFPKAMETTTTTTSTTSPATP SAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPI RASPRSTTARNTAAPATVPSTTAPFFSSSTLGSRP PVPGTPSTQAMPSWPTAAYATSSYLHDSTPSWTLS PFQDAASSSSSSSSSATTTTPETSTSPKFHTTTYS TERSEHFKPCRDKDLAYCLNDGECFVIETLTGSHK HCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEF MESEEVYQRQ
Expression Region
1-360aa
Sequence Info
Extracellular Domain
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
53.8 kDa
Alternative Name
Pro-NRG3
Relevance
Direct ligand for the ERBB4 tyrosine kinase receptor. Binding results in ligand-stimulated tyrosine phosphorylation and activation of the receptor. Does not bind to the EGF receptor, ERBB2 or ERBB3 receptors. May be a survival factor for oligodendrocytes
Reference
"Neuregulin-3 (NRG3): a novel neural tissue-enriched protein that binds and activates ErbB4."Zhang D., Sliwkowski M.X., Mark M., Frantz G., Akita R., Sun Y., Hillan K., Crowley C., Brush J., Godowski P.J.Proc. Natl. Acad. Sci. U.S.A. 94:9562-9567(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Direct ligand for the ERBB4 tyrosine kinase receptor. Binding results in ligand-stimulated tyrosine phosphorylation and activation of the receptor. Does not bind to the EGF receptor, ERBB2 or ERBB3 receptors. May be a survival factor for oligodendrocytes.
Subcellular Location
Pro-neuregulin-3, membrane-bound isoform: Cell membrane, Single-pass type I membrane protein, Note=Does not seem to be active, SUBCELLULAR LOCATION: Neuregulin-3: Secreted, SUBCELLULAR LOCATION: Isoform 3: Cell membrane, Single-pass type I membrane protein
Protein Families
Neuregulin family
Tissue Specificity
Highly expressed in most regions of the brain with the exception of corpus callosum. Expressed at lower level in testis. Not detected in heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, ovary, small intestine, colon and peripheral blood leukocytes.
Paythway
ErbBsignalingpathway
Amount: 500ug
Available: In stock
Listprice: €1,013.82
Price: €1,013.82
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close