Comparison

Recombinant Human Pro-neuregulin-3, membrane-bound isoform(NRG3),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP016079HU-500
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Pro-NRG3
AA Sequence
MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAAG GGPDGGGEGAAEPPRELRCSDCIVWNRQQTWLCVV PLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDS KGMGQDPFFLSKPSSFPKAMETTTTTTSTTSPATP SAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPI RASPRSTTARNTAAPATVPSTTAPFFSSSTLGSRP PVPGTPSTQAMPSWPTAAYATSSYLHDSTPSWTLS PFQDAASSSSSSSSSATTTTPETSTSPKFHTTTYS TERSEHFKPCRDKDLAYCLNDGECFVIETLTGSHK HCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEF MESEEVYQRQ
Research Topic
Cancer
Uniprot ID
P56975
Gene Names
NRG3
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-360aa
MW of Fusion Proten
53, 8
Sequence Info
Extracellular Domain
Relevance
Direct ligand for the ERBB4 tyrosine kinase receptor. Binding results in ligand-stimulated tyrosine phosphorylation and activation of the receptor. Does not bind to the EGF receptor, ERBB2 or ERBB3 receptors. May be a survival factor for oligodendrocytes
Reference
"Neuregulin-3 (NRG3): a novel neural tissue-enriched protein that binds and activates ErbB4."Zhang D., Sliwkowski M.X., Mark M., Frantz G., Akita R., Sun Y., Hillan K., Crowley C., Brush J., Godowski P.J.Proc. Natl. Acad. Sci. U.S.A. 94:9562-9567(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 500ug
Available: In stock
Listprice: €880.00
Price: €880.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close