Comparison

Recombinant Human Neurotensin/neuromedin N(NTS) ,partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP016136HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
NmN-125Neuromedin N ; NN ; NmNNeurotensin ; NTTail peptide
AA Sequence
SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTL LNVCSLVNNLNSPAEETGEVHEEELVARRKLPTAL DGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILD TGNDKNGKEEVIKRK
Research Topic
Neuroscience
Uniprot ID
P30990
Gene Names
NTS
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
24-143aa
MW of Fusion Proten
29, 7
Sequence Info
Partial
Relevance
Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
Reference
Intermolecular interactions between the neurotensin and the third Extracellular domain loop of human neurotensin 1 receptor.Da Costa G., Bondon A., Coutant J., Curmi P., Monti J.P.J. Biomol. Struct. Dyn. 31:1381-1392(2013)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close