Comparison

Recombinant Human Nuclear pore complex protein Nup153(NUP153),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP016190HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
153 kDa nucleoporinNucleoporin Nup153
AA Sequence
KAGSSWQCDTCLLQNKVTDNKCIACQAAKLSPRDT AKQTGIETPNKSGKTTLSASGTGFGDKFKPVIGTW DCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLT VVSESAETMTASSSSCTVTTGTLGFGDKFKRPIGS WECSVCCVSNNAEDNKCVSCMSEKPGSSVPASSSS TVPVSLPSGGSLGLEKFKKPEGSWDCELCLVQNKA DSTKCLACESAKPG
Research Topic
Immunology
Uniprot ID
P49790
Gene Names
NUP153
Tag Info
N-terminal 6xHis-tagged
Expression Region
657-880aa
MW of Fusion Proten
27, 3
Sequence Info
Partial
Relevance
Component of the nuclear pore complex (NPC), a complex required for the trafficking across the nuclear envelope. Functions as a scaffolding elent in the nuclear phase of the NPC essential for normal nucleoCytoplasmic domain transport of proteins and mRNAs. Involved in the quality control and retention of unspliced mRNAs in the nucleus; in association with TPR, regulates the nuclear export of unspliced mRNA species bearing constitutive transport elent (CTE) in a NXF1- and KHDRBS1-independent manner. Mediates TPR anchoring to the nuclear mbrane at NPC. The repeat-containing domain may be involved in anchoring other components of the NPC to the pore mbrane. Possible DNA-binding subunit of the nuclear pore complex (NPC).
Reference
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close