Comparison

Recombinant Human Nuclear transport factor 2(NUTF2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP016214HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Placental protein 15
AA Sequence
MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYID ASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITA QDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLL KNINDAWVCTNDMFRLALHNFG
Research Topic
Signal Transduction
Uniprot ID
P61970
Gene Names
NUTF2
Tag Info
N-terminal GST-tagged
Expression Region
1-127aa
MW of Fusion Proten
41, 5
Sequence Info
Full Length
Relevance
Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import.
Reference
"Identification of NTF2, a cytosolic factor for nuclear import that interacts with nuclear pore complex protein p62."
Paschal B.M., Gerace L.
J. Cell Biol. 129:925-937(1995)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close