Comparison

Recombinant Human Odontogenic ameloblast-associated protein(ODAM)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP016268HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Apin
AA Sequence
APLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPL NSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAG LLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQ PGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWE QPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLA EPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYL QKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQ TITPELPEEKDKTDSLREP
Research Topic
Signal Transduction
Uniprot ID
A1E959
Gene Names
ODAM
Tag Info
N-terminal 6xHis-tagged
Expression Region
16-279aa
MW of Fusion Proten
33, 2
Sequence Info
Full Length of Mature Protein
Relevance
Tooth-associated epithelia protein that probably plays a role in odontogenesis, the complex process that results in the initiation and generation of the tooth. May be incorporated in the enamel matrix at the end of mineralization process. Involved in the induction of RHOA activity via interaction with ARHGEF and expression of downstream factors such as ROCK. Plays a role in attachment of the junctional epithelium to the tooth surface.
Reference
"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team
Genome Res. 14:2121-2127(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close