Comparison

Recombinant Human N-glycosylase/DNA lyase(OGG1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP016313HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Including the following 2 domains:
8-oxoguanine DNA glycosylase (EC:3.2.2.-)
DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18)
Short name:
AP lyase
AA Sequence
MPARALLPRRMGHRTLASTPALWASIPCPRSELRL DLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTE EQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVT LAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIEC LFSFICSSNNNIARITGMVERLCQAFGPRLIQLDD VTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSA SARAILEEQGGLAWLQQLRESSYEEAHKALCILPG VGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYS WHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQ AVLFSADLRQSRHAQEPPAKRRKGSKGPEG
Research Topic
Cancer
Uniprot ID
O15527
Gene Names
OGG1
Tag Info
N-terminal 6xHis-tagged
Expression Region
1-345aa
MW of Fusion Proten
42, 8
Sequence Info
Full Length
Relevance
DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7, 8-dihydro-8-oxoguanine and 2, 6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion.
Reference
"Cloning and characterization of mammalian 8-hydroxyguanine-specific DNA glycosylase/apurinic, apyrimidinic lyase, a functional mutM homologue."Aburatani H., Hippo Y., Ishida T., Takashima R., Matsuba C., Kodama T., Takao M., Yasui A., Yamamoto K., Asano M., Fukasawa K., Yoshinari T., Inoue H., Otsuka E., Nishimura S.Cancer Res. 57:2151-2156(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close