Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
500ug |
Host |
E.coli |
Item no. |
CSB-EP016313HU-500 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Cancer |
Uniprot ID |
O15527 |
Gene Names |
OGG1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MPARALLPRRMGHRTLASTPALWASIPCPRSELRL DLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTE EQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVT LAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIEC LFSFICSSNNNIARITGMVERLCQAFGPRLIQLDD VTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSA SARAILEEQGGLAWLQQLRESSYEEAHKALCILPG VGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYS WHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQ AVLFSADLRQSRHAQEPPAKRRKGSKGPEG |
Expression Region |
1-345aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
42.8 kDa |
Alternative Name(s) |
Including the following 2 domains: 8-oxoguanine DNA glycosylase (EC:3.2.2.-) DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18) Short name: AP lyase |
Relevance |
DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7, 8-dihydro-8-oxoguanine and 2, 6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion. |
Reference |
"Cloning and characterization of mammalian 8-hydroxyguanine-specific DNA glycosylase/apurinic, apyrimidinic lyase, a functional mutM homologue."Aburatani H., Hippo Y., Ishida T., Takashima R., Matsuba C., Kodama T., Takao M., Yasui A., Yamamoto K., Asano M., Fukasawa K., Yoshinari T., Inoue H., Otsuka E., Nishimura S.Cancer Res. 57:2151-2156(1997) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7, 8-dihydro-8-oxoguanine and 2, 6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion. |
Involvement in disease |
Renal cell carcinoma (RCC) |
Subcellular Location |
Nucleus, nucleoplasm, Nucleus speckle, Nucleus matrix |
Protein Families |
Type-1 OGG1 family |
Tissue Specificity |
Ubiquitous. |
Paythway |
DNArepairpathway |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.