« Back
Home /
Recombinant Human N-glycosylase/DNA lyase(OGG1)

Recombinant Human N-glycosylase/DNA lyase(OGG1)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	500ug
Host	E.coli
Item no.	CSB-EP016313HU-500
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Cancer
Uniprot ID	O15527
Gene Names	OGG1
Organism	Homo sapiens (Human)
AA Sequence	MPARALLPRRMGHRTLASTPALWASIPCPRSELRL DLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTE EQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVT LAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIEC LFSFICSSNNNIARITGMVERLCQAFGPRLIQLDD VTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSA SARAILEEQGGLAWLQQLRESSYEEAHKALCILPG VGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYS WHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQ AVLFSADLRQSRHAQEPPAKRRKGSKGPEG
Expression Region	1-345aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	42.8 kDa
Alternative Name(s)	Including the following 2 domains: 8-oxoguanine DNA glycosylase (EC:3.2.2.-) DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18) Short name: AP lyase
Relevance	DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7, 8-dihydro-8-oxoguanine and 2, 6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion.
Reference	"Cloning and characterization of mammalian 8-hydroxyguanine-specific DNA glycosylase/apurinic, apyrimidinic lyase, a functional mutM homologue."Aburatani H., Hippo Y., Ishida T., Takashima R., Matsuba C., Kodama T., Takao M., Yasui A., Yamamoto K., Asano M., Fukasawa K., Yoshinari T., Inoue H., Otsuka E., Nishimura S.Cancer Res. 57:2151-2156(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7, 8-dihydro-8-oxoguanine and 2, 6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion.
Involvement in disease	Renal cell carcinoma (RCC)
Subcellular Location	Nucleus, nucleoplasm, Nucleus speckle, Nucleus matrix
Protein Families	Type-1 OGG1 family
Tissue Specificity	Ubiquitous.
Paythway	DNArepairpathway
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP016313HU-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time