Comparison

Recombinant Rat Osteocrin(Ostn)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP017269RA-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P61365
Gene Names
Ostn
Organism
Rattus norvegicus (Rat)
AA Sequence
SFSGFGSPLDRLSAGSVEHRGKQRRVVDHSKKRFG IPMDRIGRNRLSSSR
Expression Region
82-131aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
21.6 kDa
Alternative Name
Musclin
Relevance
Appears to modulate osteoblastic differentiation. Could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle
Reference
"Osteocrin, a novel bone-specific secreted protein that modulates the osteoblast phenotype."Thomas G., Moffatt P., Salois P., Gaumond M.-H., Gingras R., Godin E., Miao D., Goltzman D., Lanctot C.J. Biol. Chem. 278:50563-50571(2003)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Hormone that acts as a ligand for natriuretic peptide receptor NPR3/NPR-C and promotes bone growth and physical endurance in muscle. Acts as a regulator of osteoblast differentiation and bone growth by binding to natriuretic peptide receptor NPR3/NPR-C, thereby preventing binding between NPR3/NPR-C and natriuretic peptides, leading to increase cGMP production. Required to enhance physical endurance
Subcellular Location
Secreted
Protein Families
Osteocrin family
Tissue Specificity
Highly expressed in skeletal muscle (PubMed:15044443). Also expressed in leg tendons/ligaments and osteoblasts (PubMed:17951249). In long bones and teeth, present in knee joint and periodontal ligaments (at protein level) (PubMed:17951249).
Amount: 1mg
Available: In stock
Listprice: €2,191.83
Price: €2,191.83
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close