Comparison

Recombinant Rat Osteocrin(Ostn)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP017269RA-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Musclin
AA Sequence
SFSGFGSPLDRLSAGSVEHRGKQRRVVDHSKKRFG IPMDRIGRNRLSSSR
Research Topic
Others
Uniprot ID
P61365
Gene Names
Ostn
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
82-131aa
MW of Fusion Proten
21, 6
Sequence Info
Full Length
Relevance
Appears to modulate osteoblastic differentiation. Could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle
Reference
"Osteocrin, a novel bone-specific secreted protein that modulates the osteoblast phenotype."Thomas G., Moffatt P., Salois P., Gaumond M.-H., Gingras R., Godin E., Miao D., Goltzman D., Lanctot C.J. Biol. Chem. 278:50563-50571(2003)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Rattus norvegicus (Rat)
Amount: 200ug
Available: In stock
Listprice: €780.22
Price: €780.22
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close