Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
50ug |
Host |
E.coli |
Item no. |
CSB-EP017306HU-50 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Cancer |
Uniprot ID |
P55809 |
Gene Names |
OXCT1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
TKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLI DALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIK RMVSSYVGENAEFERQYLSGELEVELTPQGTLAER IRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGS VAIASKPREVREFNGQHFILEEAITGDFALVKAWK ADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIV DIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSI RKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYA NLGIGIPLLASNFISPNITVHLQSENGVLGLGPYP RQHEADADLINAGKETVTILPGASFFSSDESFAMI RGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMG GAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLP LTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLT VDDVQKSTGCDFAVSPKLMPMQQIAN |
Expression Region |
40-520aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
56.1 kDa |
Alternative Name(s) |
3-oxoacid CoA-transferase 1Somatic-type succinyl-CoA:3-oxoacid CoA-transferase ; SCOT-s |
Relevance |
Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate. |
Reference |
Clinical and molecular characterization of five patients with succinyl-CoA:3-ketoacid CoA transferase (SCOT) deficiency.Fukao T., Sass J.O., Kursula P., Thimm E., Wendel U., Ficicioglu C., Monastiri K., Guffon N., Baric I., Zabot M.T., Kondo N.Biochim. Biophys. Acta 1812:619-624(2011) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate. |
Involvement in disease |
Succinyl-CoA:3-oxoacid CoA transferase deficiency (SCOTD) |
Subcellular Location |
Mitochondrion matrix |
Protein Families |
3-oxoacid CoA-transferase family |
Tissue Specificity |
Abundant in heart, followed in order by kidney, brain, and muscle, whereas in liver it is undetectable; also detectable in leukocytes and fibroblasts. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.