Recombinant Human Polyadenylate-binding protein 1(PABPC1),partial

Epigenetics and Nuclear Signaling

Not Test

Homo sapiens (Human)

MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAG PILSIRVCRDMITRRSLGYAYVNFQQPADAERALD TMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKN LDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGY GFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKS RKEREAELGARAKEFTNVYIKNFGEDMDDERLKDL FGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQ KAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKF EQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFS PFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAV TEMNGRIVATKPLYVALAQR

1-370aa

57.8 kDa

Binds the poly(A) tail of mRNA, including that of its own transcript. May be involved in Cytoplasmic domain regulatory processes of mRNA metabolism such as pre-mRNA splicing. Its function in translational initiation regulation can either be enhanced by PAIP1 or repressed by PAIP2. Can probably bind to Cytoplasmic domain RNA sequences other than poly(A) in vivo. Involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the Cytoplasmic domain deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Involved in regulation of nonsense-mediated decay (NMD) of mRNAs containing prature stop codons; for the recognition of prature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed.

Greater than 90% as determined by SDS-PAGE.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.

Binds the poly(A) tail of mRNA, including that of its own transcript. May be involved in cytoplasmic regulatory processes of mRNA metabolism such as pre-mRNA splicing. Its function in translational initiation regulation can either be enhanced by PAIP1 or repressed by PAIP2. Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo. Involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Involved in regulation of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons; for the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed. By binding to long poly(A) tails, may protect them from uridylation by ZCCHC6/ZCCHC11 and hence contribute to mRNA stability

Polyadenylate-binding protein type-1 family

N-terminal 6xHis-SUMO-tagged