Comparison

Recombinant Human Polyadenylate-binding protein 1(PABPC1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP017352HU-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P11940
Gene Names
PABPC1
Organism
Homo sapiens (Human)
AA Sequence
MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAG PILSIRVCRDMITRRSLGYAYVNFQQPADAERALD TMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKN LDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGY GFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKS RKEREAELGARAKEFTNVYIKNFGEDMDDERLKDL FGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQ KAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKF EQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFS PFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAV TEMNGRIVATKPLYVALAQR
Expression Region
1-370aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
57.8 kDa
Relevance
Binds the poly(A) tail of mRNA, including that of its own transcript. May be involved in Cytoplasmic domain regulatory processes of mRNA metabolism such as pre-mRNA splicing. Its function in translational initiation regulation can either be enhanced by PAIP1 or repressed by PAIP2. Can probably bind to Cytoplasmic domain RNA sequences other than poly(A) in vivo. Involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the Cytoplasmic domain deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Involved in regulation of nonsense-mediated decay (NMD) of mRNAs containing prature stop codons; for the recognition of prature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed.
Reference
Human senataxin resolves RNA/DNA hybrids formed at transcriptional pause sites to promote Xrn2-dependent termination.Skourti-Stathaki K., Proudfoot N.J., Gromak N.Mol. Cell 42:794-805(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Binds the poly(A) tail of mRNA, including that of its own transcript. May be involved in cytoplasmic regulatory processes of mRNA metabolism such as pre-mRNA splicing. Its function in translational initiation regulation can either be enhanced by PAIP1 or repressed by PAIP2. Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo. Involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Involved in regulation of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons; for the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed. By binding to long poly(A) tails, may protect them from uridylation by ZCCHC6/ZCCHC11 and hence contribute to mRNA stability
Subcellular Location
Cytoplasm, Nucleus
Protein Families
Polyadenylate-binding protein type-1 family
Tissue Specificity
Ubiquitous.
Amount: 200ug
Available: In stock
Listprice: €628.34
Price: €628.34
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close