Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
500ug |
Host |
E.coli |
Item no. |
CSB-EP017352HU-500 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research areas |
Epigenetics and Nuclear Signaling |
Target / Protein |
PABPC1 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P11940 |
AA Sequence |
MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAG PILSIRVCRDMITRRSLGYAYVNFQQPADAERALD TMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKN LDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGY GFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKS RKEREAELGARAKEFTNVYIKNFGEDMDDERLKDL FGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQ KAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKF EQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFS PFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAV TEMNGRIVATKPLYVALAQR |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
1-370aa |
Protein length |
Partial |
MW |
57.8 kDa |
Relevance |
Binds the poly(A) tail of mRNA, including that of its own transcript. May be involved in Cytoplasmic domain regulatory processes of mRNA metabolism such as pre-mRNA splicing. Its function in translational initiation regulation can either be enhanced by PAIP1 or repressed by PAIP2. Can probably bind to Cytoplasmic domain RNA sequences other than poly(A) in vivo. Involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the Cytoplasmic domain deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Involved in regulation of nonsense-mediated decay (NMD) of mRNAs containing prature stop codons; for the recognition of prature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed. |
References |
Human senataxin resolves RNA/DNA hybrids formed at transcriptional pause sites to promote Xrn2-dependent termination.Skourti-Stathaki K., Proudfoot N.J., Gromak N.Mol. Cell 42:794-805(2011) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Binds the poly(A) tail of mRNA, including that of its own transcript. May be involved in cytoplasmic regulatory processes of mRNA metabolism such as pre-mRNA splicing. Its function in translational initiation regulation can either be enhanced by PAIP1 or repressed by PAIP2. Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo. Involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Involved in regulation of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons; for the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed. By binding to long poly(A) tails, may protect them from uridylation by ZCCHC6/ZCCHC11 and hence contribute to mRNA stability |
Subcellular Location |
Cytoplasm, Nucleus |
Protein Families |
Polyadenylate-binding protein type-1 family |
Tissue Specificity |
Ubiquitous. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.