Comparison

Recombinant Human Paralemmin-1(PALM)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP017413HU-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Neuroscience
Uniprot ID
O75781
Gene Names
PALM
Organism
Homo sapiens (Human)
AA Sequence
MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQL EDERRQLQHLKSKALRERWLLEGTPSSASEGDEDL RRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAP ATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQ TPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEIT VEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDET KVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLS EAGSTAGAAETRGAVEGAARTTPSRREITGVQAQP GEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETK KVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEP PTEAASREENQAGPEATTSDPQDLDMKKHRCKCC
Expression Region
1-384aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
45.7 kDa
Alternative Name
Paralemmin
Relevance
Involved in plasma membrane dynamics and cell process formation. Isoform 1 and isoform 2 are necessary for axonal and dendritic filopodia induction, for dendritic spine maturation and synapse formation in a palmitoylation-dependent manner.
Reference
"A quantitative atlas of mitotic phosphorylation."Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Involved in plasma membrane dynamics and cell process formation. Isoform 1 and isoform 2 are necessary for axonal and dendritic filopodia induction, for dendritic spine maturation and synapse formation in a palmitoylation-dependent manner.
Subcellular Location
Cell membrane, Lipid-anchor, Cytoplasmic side, Cell projection, filopodium membrane, Lipid-anchor, Cell projection, axon, Cell projection, dendrite, Cell projection, dendritic spine, Basolateral cell membrane, Lipid-anchor, Apicolateral cell membrane, Lipid-anchor
Protein Families
Paralemmin family
Tissue Specificity
Widely expressed with highest expression in brain and testis and intermediate expression in heart and adrenal gland.
Amount: 200ug
Available: In stock
Listprice: €628.34
Price: €628.34
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close