Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
50ug |
Host |
E.coli |
Item no. |
CSB-EP017413HU-50 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Neuroscience |
Uniprot ID |
O75781 |
Gene Names |
PALM |
Organism |
Homo sapiens (Human) |
AA Sequence |
MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQL EDERRQLQHLKSKALRERWLLEGTPSSASEGDEDL RRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAP ATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQ TPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEIT VEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDET KVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLS EAGSTAGAAETRGAVEGAARTTPSRREITGVQAQP GEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETK KVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEP PTEAASREENQAGPEATTSDPQDLDMKKHRCKCC |
Expression Region |
1-384aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
45.7 kDa |
Alternative Name(s) |
Paralemmin |
Relevance |
Involved in plasma membrane dynamics and cell process formation. Isoform 1 and isoform 2 are necessary for axonal and dendritic filopodia induction, for dendritic spine maturation and synapse formation in a palmitoylation-dependent manner. |
Reference |
"A quantitative atlas of mitotic phosphorylation."Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Involved in plasma membrane dynamics and cell process formation. Isoform 1 and isoform 2 are necessary for axonal and dendritic filopodia induction, for dendritic spine maturation and synapse formation in a palmitoylation-dependent manner. |
Subcellular Location |
Cell membrane, Lipid-anchor, Cytoplasmic side, Cell projection, filopodium membrane, Lipid-anchor, Cell projection, axon, Cell projection, dendrite, Cell projection, dendritic spine, Basolateral cell membrane, Lipid-anchor, Apicolateral cell membrane, Lipid-anchor |
Protein Families |
Paralemmin family |
Tissue Specificity |
Widely expressed with highest expression in brain and testis and intermediate expression in heart and adrenal gland. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.