Comparison

Recombinant Human Paralemmin-1(PALM)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP017413HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Paralemmin
AA Sequence
MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQL EDERRQLQHLKSKALRERWLLEGTPSSASEGDEDL RRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAP ATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQ TPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEIT VEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDET KVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLS EAGSTAGAAETRGAVEGAARTTPSRREITGVQAQP GEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETK KVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEP PTEAASREENQAGPEATTSDPQDLDMKKHRCKCC
Research Topic
Neuroscience
Uniprot ID
O75781
Gene Names
PALM
Tag Info
N-terminal 6xHis-tagged
Expression Region
1-384aa
MW of Fusion Proten
45, 7
Sequence Info
Full Length
Relevance
Involved in plasma membrane dynamics and cell process formation. Isoform 1 and isoform 2 are necessary for axonal and dendritic filopodia induction, for dendritic spine maturation and synapse formation in a palmitoylation-dependent manner.
Reference
"A quantitative atlas of mitotic phosphorylation."Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 50ug
Available: In stock
Listprice: €199.38
Price: €199.38
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close