Comparison

Recombinant Human Phosphoenolpyruvate carboxykinase, cytosolic [GTP](PCK1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP017613HU-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MPPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNA ELCQPDHIHICDGSEEENGRLLGQMEEEGILRRLK KYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPI PKTGLSQLGRWMSEEDFEKAFNARFPGCMKGRTMY VIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTR MGTPVLEAVGDGEFVKCLHSVGCPLPLQKPLVNNW PCNPELTLIAHLPDRREIISFGSGYGGNSLLGKKC FALRMASRLAKEEGWLAEHMLILGITNPEGEKKYL AAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWM KFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKT IQKNTIFTNVAETSDGGVYWEGIDEPLASGVTITS WKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAW ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVF VGAAMRSEATAAAEHKGKIIMHDPFAMRPFFGYNF GKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKF LWPGFGENSRVLEWMFNRIDGKASTKLTPIGYIPK EDALNLKGLGHINMMELFSISKEFWEKEVEDIEKY LEDQVNADLPCEIEREILALKQRISQM
Research Topic
Metabolism
Uniprot ID
P35558
Gene Names
PCK1
Tag Info
N-terminal 6xHis-tagged
Expression Region
1-622aa
MW of Fusion Proten
73, 2
Sequence Info
Full Length
Relevance
Catalyzes the conversion of oxaloacetate (OAA) to phosphoenolpyruvate (PEP), the rate-limiting step in the metabolic pathway that produces glucose from lactate and other precursors derived from the citric acid cycle.
Reference
The DNA sequence and comparative analysis of human chromosome 20.Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.Nature 414:865-871(2001)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close