Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-EP017621HU-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Cancer |
Uniprot ID |
P12004 |
Gene Names |
PCNA |
Organism |
Homo sapiens (Human) |
AA Sequence |
MFEARLVQGSILKKVLEALKDLINEACWDISSSGV NLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGV NLTSMSKILKCAGNEDIITLRAEDNADTLALVFEA PNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMP SGEFARICRDLSHIGDAVVISCAKDGVKFSASGEL GNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALR YLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMG HLKYYLAPKIEDEEGS |
Expression Region |
1-261aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
32.8 kDa |
Alternative Name(s) |
Cyclin |
Relevance |
Auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Plays a key role in DNA damage response (DDR) by being conveniently positioned at the replication fork to coordinate DNA replication with DNA repair and DNA damage tolerance pathways (PubMed:24939902). Acts as a loading platform to recruit DDR proteins that allow completion of DNA replication after DNA damage and promote postreplication repair: Monoubiquitinated PCNA leads to recruitment of translesion (TLS) polymerases, while 'Lys-63'-linked polyubiquitination of PCNA is involved in error-free pathway and employs recombination mechanisms to synthesize across the lesion. |
Reference |
"Cloning and sequence of the human nuclear protein cyclin: homology with DNA-binding proteins."Almendral J.M., Huebsch D., Blundell P.A., Macdonald-Bravo H., Bravo R.Proc. Natl. Acad. Sci. U.S.A. 84:1575-1579(1987) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Plays a key role in DNA damage response (DDR) by being conveniently positioned at the replication fork to coordinate DNA replication with DNA repair and DNA damage tolerance pathways |
Involvement in disease |
Ataxia-telangiectasia-like disorder 2 (ATLD2) |
Subcellular Location |
Nucleus |
Protein Families |
PCNA family |
Paythway |
Cellcycle |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.