Comparison

Recombinant Saccharomyces cerevisiae Proliferating cell nuclear antigen(POL30)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP017621SVG-500
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P15873
Gene Names
POL30
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
AA Sequence
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGI IAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGM DLTSLSKILRCGNNTDTLTLIADNTPDSIILLFED TKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLP SSEFSKIVRDLSQLSDSINIMITKETIKFVADGDI GSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAK YLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGF LQFFLAPKFNDEE
Expression Region
1-258aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
44.9 kDa
Alternative Name(s)
PCNA
Relevance
This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Involved in DNA repair.
Reference
"Molecular cloning, structure and expression of the yeast proliferating cell nuclear antigen gene."Bauer G.A., Burgess P.M.J.Nucleic Acids Res. 18:261-265(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Involved in DNA repair.
Subcellular Location
Nucleus
Protein Families
PCNA family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 500ug
Available: In stock
available
Questions about this Product?
 
Close