Comparison

Recombinant Human Procollagen C-endopeptidase enhancer 2(PCOLCE2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP017632HU-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Procollagen COOH-terminal proteinase enhancer 2
Short name:
PCPE-2
Short name:
Procollagen C-proteinase enhancer 2
AA Sequence
QSPERPVFTCGGILTGESGFIGSEGFPGVYPPNSK CTWKITVPEGKVVVLNFRFIDLESDNLCRYDFVDV YNGHANGQRIGRFCGTFRPGALVSSGNKMMVQMIS DANTAGNGFMAMFSAAEPNERGDQYCGGLLDRPSG SFKTPNWPDRDYPAGVTCVWHIVAPKNQLIELKFE KFDVERDNYCRYDYVAVFNGGEVNDARRIGKYCGD SPPAPIVSERNELLIQFLSDLSLTADGFIGHYIFR PKKLPTTTEQPVTTTFPVTTGLKPTVALCQQKCRR TGTLEGNYCSSDFVLAGTVITTITRDGSLHATVSI INIYKEGNLAIQQAGKNMSARLTVVCKQCPLLRRG LNYIIMGQVGEDGRGKIMPNSFIMMFKTKNQKLLD ALKNKQC
Research Topic
Cell Biology
Uniprot ID
Q9UKZ9
Gene Names
PCOLCE2
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
24-415aa
MW of Fusion Proten
59, 3
Sequence Info
Full Length
Relevance
Binds to the C-terminal propeptide of types I and II procollagens and may enhance the cleavage of that propeptide by BMP1.
Reference
"PCOLCE2 encodes a functional procollagen C-proteinase enhancer (PCPE2) that is a collagen-binding protein differing in distribution of expression and post-translational modification from the previously described PCPE1."Steiglitz B.M., Keene D.R., Greenspan D.S.J. Biol. Chem. 277:49820-49830(2002)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close