Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
50ug |
Host |
E.coli |
Item no. |
CSB-EP017632HU-50 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Cell Biology |
Uniprot ID |
Q9UKZ9 |
Gene Names |
PCOLCE2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
QSPERPVFTCGGILTGESGFIGSEGFPGVYPPNSK CTWKITVPEGKVVVLNFRFIDLESDNLCRYDFVDV YNGHANGQRIGRFCGTFRPGALVSSGNKMMVQMIS DANTAGNGFMAMFSAAEPNERGDQYCGGLLDRPSG SFKTPNWPDRDYPAGVTCVWHIVAPKNQLIELKFE KFDVERDNYCRYDYVAVFNGGEVNDARRIGKYCGD SPPAPIVSERNELLIQFLSDLSLTADGFIGHYIFR PKKLPTTTEQPVTTTFPVTTGLKPTVALCQQKCRR TGTLEGNYCSSDFVLAGTVITTITRDGSLHATVSI INIYKEGNLAIQQAGKNMSARLTVVCKQCPLLRRG LNYIIMGQVGEDGRGKIMPNSFIMMFKTKNQKLLD ALKNKQC |
Expression Region |
24-415aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
59.3 kDa |
Alternative Name(s) |
Procollagen COOH-terminal proteinase enhancer 2 Short name: PCPE-2 Short name: Procollagen C-proteinase enhancer 2 |
Relevance |
Binds to the C-terminal propeptide of types I and II procollagens and may enhance the cleavage of that propeptide by BMP1. |
Reference |
"PCOLCE2 encodes a functional procollagen C-proteinase enhancer (PCPE2) that is a collagen-binding protein differing in distribution of expression and post-translational modification from the previously described PCPE1."Steiglitz B.M., Keene D.R., Greenspan D.S.J. Biol. Chem. 277:49820-49830(2002) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Binds to the C-terminal propeptide of types I and II procollagens and may enhance the cleavage of that propeptide by BMP1. |
Subcellular Location |
Secreted |
Tissue Specificity |
Highly expressed in the heart, trabecular meshwork, pituitary gland, bladder, mammary gland, trachea and placenta and weakly expressed in the brain. Expressed in cartilage. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.