Comparison

Recombinant Rat Neuroendocrine convertase 2(Pcsk2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP017642RA-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
NEC 2
Alternative name(s):
KEX2-like endoprotease 2
Prohormone convertase 2
Proprotein convertase 2
Short name:
PC2
AA Sequence
GYRDINEIDINMNDPLFTKQWYLFNTGQADGTPGL DLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAY NYNSDASYDFSSNDPYPYPRYTDDWFNSHGTRCAG EVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDI IEASSISHMPQLIDIYSASWGPTDNGKTVDGPREL TLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNC DGYASSMWTISINSAINDGRTALYDESCSSTLAST FSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPE AAGVFALALEANVDLTWRDMQHLTVLTSKRNQLHD EVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDW KTVPERFHCVGGSVQNPEKIPPTGKLVLTLQTNAC EGKENFVRYLEHVQAVITVNATRRGDLNINMTSPM GTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDA RGTWTLELGFVGSAPQKGLLKEWTLMLHGTQSAPY IDQVVRDYQSKLAMSKKQELEEELDEAVERSLQSI LRKN
Research Topic
Signal Transduction
Uniprot ID
P28841
Gene Names
Pcsk2
Tag Info
N-terminal 6xHis-tagged
Expression Region
109-637aa
MW of Fusion Proten
62, 3
Sequence Info
Full Length
Relevance
Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Responsible for the release of glucagon from proglucagon in pancreatic A cells (By similarity).
Reference
"Isolation of two complementary deoxyribonucleic acid clones from a rat insulinoma cell line based on similarities to Kex2 and furin sequences and the specific localization of each transcript to endocrine and neuroendocrine tissues in rats."Hakes D.J., Birch N.P., Mezey A., Dixon J.E.Endocrinology 129:3053-3063(1991).
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Rattus norvegicus (Rat)
Amount: 50ug
Available: In stock
Listprice: €377.15
Price: €377.15
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close