Comparison

Recombinant Mouse Proprotein convertase subtilisin/kexin type 5(Pcsk5)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP017644MO-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Proprotein convertase 5 ; PC5Proprotein convertase 6 ; PC6Subtilisin-like proprotein convertase 6 ; SPC6Subtilisin/kexin-like protease PC5
AA Sequence
DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSD MNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQN YDALASCDVNGNDLDPMPRYDASNENKHGTRCAGE VAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVE AKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTR QAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCD GYTNSIYTISISSTAESGKKPWYLEECSSTLATTY SSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAG IIALALEANPFLTWRDVQHVIVRTSRAGHLNANDW KTNAAGFKVSHLYGFGLMDAE
Research Topic
Others
Uniprot ID
Q04592
Gene Names
Pcsk5
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
117-452aa
MW of Fusion Proten
52, 7
Sequence Info
Full Length
Relevance
Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors .
Reference
Identification of an isoform with an extremely large Cys-rich region of PC6, a Kex2-like processing endoprotease.Nakagawa T., Murakami K., Nakayama K.FEBS Lett. 327:165-171(1993)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Mus musculus (Mouse)
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close