« Back
Home /
Recombinant Mouse Proprotein convertase subtilisin/kexin type 5(Pcsk5)

Recombinant Mouse Proprotein convertase subtilisin/kexin type 5(Pcsk5)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	100ug
Host	E.coli
Item no.	CSB-EP017644MO-100
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Others
Uniprot ID	Q04592
Gene Names	Pcsk5
Organism	Mus musculus (Mouse)
AA Sequence	DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSD MNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQN YDALASCDVNGNDLDPMPRYDASNENKHGTRCAGE VAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVE AKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTR QAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCD GYTNSIYTISISSTAESGKKPWYLEECSSTLATTY SSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAG IIALALEANPFLTWRDVQHVIVRTSRAGHLNANDW KTNAAGFKVSHLYGFGLMDAE
Expression Region	117-452aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	52.7 kDa
Alternative Name(s)	Proprotein convertase 5 ; PC5Proprotein convertase 6 ; PC6Subtilisin-like proprotein convertase 6 ; SPC6Subtilisin/kexin-like protease PC5
Relevance	Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors .
Reference	Identification of an isoform with an extremely large Cys-rich region of PC6, a Kex2-like processing endoprotease.Nakagawa T., Murakami K., Nakayama K.FEBS Lett. 327:165-171(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Serine endoprotease that processes various proproteins by cleavage at paired basic amino acids, recognizing the RXXX[KR]R consensus motif. Likely functions in the constitutive and regulated secretory pathways. Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors.
Subcellular Location	Isoform PC5A: Secreted, Note=Secreted through the regulated secretory pathway, SUBCELLULAR LOCATION: Isoform PC5B: Endomembrane system, Single-pass type I membrane protein
Protein Families	Peptidase S8 family
Tissue Specificity	PC5A is expressed in most tissues but is most abundant in the intestine and adrenals. PC5B is expressed in the intestine, adrenals and lung but not in the brain.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP017644MO-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time