Comparison

Recombinant Mouse Proprotein convertase subtilisin/kexin type 5(Pcsk5)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP017644MO-50
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
Q04592
Gene Names
Pcsk5
Organism
Mus musculus (Mouse)
AA Sequence
DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSD MNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQN YDALASCDVNGNDLDPMPRYDASNENKHGTRCAGE VAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVE AKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTR QAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCD GYTNSIYTISISSTAESGKKPWYLEECSSTLATTY SSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAG IIALALEANPFLTWRDVQHVIVRTSRAGHLNANDW KTNAAGFKVSHLYGFGLMDAE
Expression Region
117-452aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
52.7 kDa
Alternative Name
Proprotein convertase 5 . PC5Proprotein convertase 6 . PC6Subtilisin-like proprotein convertase 6 . SPC6Subtilisin/kexin-like protease PC5
Relevance
Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors .
Reference
Identification of an isoform with an extremely large Cys-rich region of PC6, a Kex2-like processing endoprotease.Nakagawa T., Murakami K., Nakayama K.FEBS Lett. 327:165-171(1993)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Serine endoprotease that processes various proproteins by cleavage at paired basic amino acids, recognizing the RXXX[KR]R consensus motif. Likely functions in the constitutive and regulated secretory pathways. Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors.
Subcellular Location
Isoform PC5A: Secreted, Note=Secreted through the regulated secretory pathway, SUBCELLULAR LOCATION: Isoform PC5B: Endomembrane system, Single-pass type I membrane protein
Protein Families
Peptidase S8 family
Tissue Specificity
PC5A is expressed in most tissues but is most abundant in the intestine and adrenals. PC5B is expressed in the intestine, adrenals and lung but not in the brain.
Amount: 50ug
Available: In stock
Listprice: €350.03
Price: €350.03
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close