Comparison

Recombinant Mouse Protein disulfide-isomerase A2(Pdia2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP017719MO-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
D3Z6P0
Gene Names
Pdia2
Organism
Mus musculus (Mouse)
AA Sequence
QGEEPGGPSEVLPEEPTGEEVPKEDGILVLNHRTL SLALQEHSALMVEFYAPWCGHCKELAPEYSKAAAL LAAESAVVTLAKVDGPAEPELTKEFEVVGYPTLKF FQNGNRTNPEEYAGPKTAEGIAEWLRRRVGPSATH LEDEEGVQALMAKWDMVVIGFFQDLQGKDMATFLA LAKDALDMTFGFTDQPQLFEKFGLTKDTVVLFKKF DEGRADFPVDKETGLDLGDLSRFLVIHSMHLVTEF NSQTSPKIFAAKILNHLLLFVNQTLAQHRELLTDF REAAPPFRGQVLFVMVDVAADNSHVLNYFGLKAEE APTLRLINVETTKKYAPTGVIAITAASVAAFCQAV LHGEIKHYLLSQEIPPDWDQGPVKTLVSKNFEQVA FDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKD REDIVIAELDATANELEAFSVLGYPTLKFFPAGPD RKVIDYKSTRDLETFSKFLDSGGHLPKEEPKEPAA SAPEAQANSTLGPKEEL
Expression Region
21-527aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
72.2 kDa
Relevance
Acts as an intracellular estrogen-binding protein. May be involved in modulating cellular levels and biological functions of estrogens in the pancreas. May act as a chaperone that inhibits aggregation of misfolded proteins .
Reference
Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Acts as an intracellular estrogen-binding protein. May be involved in modulating cellular levels and biological functions of estrogens in the pancreas. May act as a chaperone that inhibits aggregation of misfolded proteins (By similarity).
Subcellular Location
Endoplasmic reticulum lumen
Protein Families
Protein disulfide isomerase family
Tissue Specificity
Highly expressed in pancreas.
Amount: 100ug
Available: In stock
Listprice: €560.05
Price: €560.05
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close