« Back
Home /
Recombinant Mouse Protein disulfide-isomerase A2(Pdia2)

Recombinant Mouse Protein disulfide-isomerase A2(Pdia2)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	E.coli
Item no.	CSB-EP017719MO-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Others
Uniprot ID	D3Z6P0
Gene Names	Pdia2
Organism	Mus musculus (Mouse)
AA Sequence	QGEEPGGPSEVLPEEPTGEEVPKEDGILVLNHRTL SLALQEHSALMVEFYAPWCGHCKELAPEYSKAAAL LAAESAVVTLAKVDGPAEPELTKEFEVVGYPTLKF FQNGNRTNPEEYAGPKTAEGIAEWLRRRVGPSATH LEDEEGVQALMAKWDMVVIGFFQDLQGKDMATFLA LAKDALDMTFGFTDQPQLFEKFGLTKDTVVLFKKF DEGRADFPVDKETGLDLGDLSRFLVIHSMHLVTEF NSQTSPKIFAAKILNHLLLFVNQTLAQHRELLTDF REAAPPFRGQVLFVMVDVAADNSHVLNYFGLKAEE APTLRLINVETTKKYAPTGVIAITAASVAAFCQAV LHGEIKHYLLSQEIPPDWDQGPVKTLVSKNFEQVA FDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKD REDIVIAELDATANELEAFSVLGYPTLKFFPAGPD RKVIDYKSTRDLETFSKFLDSGGHLPKEEPKEPAA SAPEAQANSTLGPKEEL
Expression Region	21-527aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	72.2 kDa
Relevance	Acts as an intracellular estrogen-binding protein. May be involved in modulating cellular levels and biological functions of estrogens in the pancreas. May act as a chaperone that inhibits aggregation of misfolded proteins .
Reference	Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as an intracellular estrogen-binding protein. May be involved in modulating cellular levels and biological functions of estrogens in the pancreas. May act as a chaperone that inhibits aggregation of misfolded proteins (By similarity).
Subcellular Location	Endoplasmic reticulum lumen
Protein Families	Protein disulfide isomerase family
Tissue Specificity	Highly expressed in pancreas.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time