Comparison

Recombinant Human PDZ and LIM domain protein 1(PDLIM1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP017731HU-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
O00151
Gene Names
PDLIM1
Organism
Homo sapiens (Human)
AA Sequence
TTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPG SKAALANLCIGDVITAIDGENTSNMTHLEAQNRIK GCTDNLTLTVARSEHKVWSPLVTEEGKRHPYKMNL ASEPQEVLHIGSAHNRSAMPFTASPASSTTARVIT NQYNNPAGLYSSENISNFNNALESKTAASGVEANS RPLDHAQPPSSLVIDKESEVYKMLQEKQELNEPPK QSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTK VAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHP ECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVT PPEGYEVVTVFPK
Expression Region
1-329aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
62.9 kDa
Alternative Name
C-terminal LIM domain protein 1
Elfin
LIM domain protein CLP-36
Relevance
Cytoskeletal protein that may act as an adapter that brings other proteins (like kinases) to the cytoskeleton.
Reference
"Characterization of the human 36-KDA carboxyl terminal LIM domain protein (hCLIM1)."
Kotaka M., Ngai S.M., Garcia-Barcelo M., Tsui S.K.W., Fung K.P., Lee C.Y., Waye M.M.Y.
J. Cell. Biochem. 72:279-285(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Cytoskeletal protein that may act as an adapter that brings other proteins (like kinases) to the cytoskeleton
Subcellular Location
Cytoplasm, Cytoplasm, cytoskeleton, Cytoplasm, myofibril, sarcomere, Z line
Tissue Specificity
Strongly expressed in the heart and skeletal muscle, moderately expressed in the spleen, small intestine, colon, placenta, and lung. A lower level expression is seen in liver, thymus, kidney, prostate and pancreas and is not found in the brain, testis, ovary, and peripheral blood leukocytes.
Amount: 200ug
Available: In stock
Listprice: €628.34
Price: €628.34
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close