Comparison

Recombinant Human PDZ and LIM domain protein 1(PDLIM1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP017731HU-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
C-terminal LIM domain protein 1
Elfin
LIM domain protein CLP-36
AA Sequence
TTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPG SKAALANLCIGDVITAIDGENTSNMTHLEAQNRIK GCTDNLTLTVARSEHKVWSPLVTEEGKRHPYKMNL ASEPQEVLHIGSAHNRSAMPFTASPASSTTARVIT NQYNNPAGLYSSENISNFNNALESKTAASGVEANS RPLDHAQPPSSLVIDKESEVYKMLQEKQELNEPPK QSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTK VAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHP ECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVT PPEGYEVVTVFPK
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
O00151
Gene Names
PDLIM1
Tag Info
N-terminal GST-tagged
Expression Region
1-329aa
MW of Fusion Proten
62, 9
Sequence Info
Full Length
Relevance
Cytoskeletal protein that may act as an adapter that brings other proteins (like kinases) to the cytoskeleton.
Reference
"Characterization of the human 36-kDa carboxyl terminal LIM domain protein (hCLIM1)."
Kotaka M., Ngai S.M., Garcia-Barcelo M., Tsui S.K.W., Fung K.P., Lee C.Y., Waye M.M.Y.
J. Cell. Biochem. 72:279-285(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close