Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
500ug |
Host |
E.coli |
Item no. |
CSB-EP017731HU-500 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
O00151 |
Gene Names |
PDLIM1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
TTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPG SKAALANLCIGDVITAIDGENTSNMTHLEAQNRIK GCTDNLTLTVARSEHKVWSPLVTEEGKRHPYKMNL ASEPQEVLHIGSAHNRSAMPFTASPASSTTARVIT NQYNNPAGLYSSENISNFNNALESKTAASGVEANS RPLDHAQPPSSLVIDKESEVYKMLQEKQELNEPPK QSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTK VAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHP ECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVT PPEGYEVVTVFPK |
Expression Region |
1-329aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
62.9 kDa |
Alternative Name(s) |
C-terminal LIM domain protein 1 Elfin LIM domain protein CLP-36 |
Relevance |
Cytoskeletal protein that may act as an adapter that brings other proteins (like kinases) to the cytoskeleton. |
Reference |
"Characterization of the human 36-KDA carboxyl terminal LIM domain protein (hCLIM1)." Kotaka M., Ngai S.M., Garcia-Barcelo M., Tsui S.K.W., Fung K.P., Lee C.Y., Waye M.M.Y. J. Cell. Biochem. 72:279-285(1999) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Cytoskeletal protein that may act as an adapter that brings other proteins (like kinases) to the cytoskeleton |
Subcellular Location |
Cytoplasm, Cytoplasm, cytoskeleton, Cytoplasm, myofibril, sarcomere, Z line |
Tissue Specificity |
Strongly expressed in the heart and skeletal muscle, moderately expressed in the spleen, small intestine, colon, placenta, and lung. A lower level expression is seen in liver, thymus, kidney, prostate and pancreas and is not found in the brain, testis, ovary, and peripheral blood leukocytes. |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.