Comparison

Recombinant mouse platelet factor 4 (Pf4)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP017809MO-500
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
C-X-C motif chemokine 4
AA Sequence
VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEV IKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVI KKILES
Research Topic
Immunology
Uniprot ID
Q9Z126
Gene Names
Pf4
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
30-105aa
MW of Fusion Proten
24, 2
Sequence Info
Full Length of Mature Protein
Relevance
Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation (By similarity).
Reference
"Significantly elevated expression of PF4 (platelet factor 4) and eotaxin in the NOA mouse, a model for atopic dermatitis."Watanabe O., Natori K., Tamari M., Shiomoto Y., Kubo S., Nakamura Y.J. Hum. Genet. 44:173-176(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Mus musculus (Mouse)
Amount: 500ug
Available: In stock
Listprice: €1,272.85
Price: €1,272.85
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close