Comparison

Recombinant Human Placenta growth factor(PGF)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP017854HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCR ALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCG DENLHCVPVETANVTMQLLKIRSGDRPSYVELTFS QHVRCECRPLREKMKPERCGDAVPRR
Research Topic
Cardiovascular
Uniprot ID
P49763
Gene Names
PGF
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
19-170aa
MW of Fusion Proten
30, 7
Sequence Info
Full Length of Isoform PlGF-2
Relevance
Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth.
Reference
HRG inhibits tumor growth and metastasis by inducing macrophage polarization and vessel normalization through downregulation of PlGF.Rolny C., Mazzone M., Tugues S., Laoui D., Johansson I., Coulon C., Squadrito M.L., Segura I., Li X., Knevels E., Costa S., Vinckier S., Dresselaer T., Akerud P., De Mol M., Salomaki H., Phillipson M., Wyns S. , Larsson E., Buysschaert I., Botling J., Himmelreich U., Van Ginderachter J.A., De Palma M., Dewerchin M., Claesson-Welsh L., Carmeliet P.Cancer Cell 19:31-44(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close