Comparison

Recombinant Human Prohibitin(PHB)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP017885HU-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHR AVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCR SRPRNVPVITGSKDLQNVNITLRILFRPVASQLPR IFTSIGEDYDERVLPSITTEILKSVVARFDAGELI TQRELVSRQVSDDLTERAATFGLILDDVSLTHLTF GKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAA IISAEGDSKAAELIANSLATAGDGLIELRKLEAAE DIAYQLSRSRNITYLPAGQSVLLQLPQ
Research Topic
Transcription
Uniprot ID
P35232
Gene Names
PHB
Tag Info
N-terminal 6xHis-tagged
Expression Region
1-272aa
MW of Fusion Proten
33, 8
Sequence Info
Full Length
Relevance
Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.
Reference
The human prohibitin gene located on chromosome 17q21 is mutated in sporadic breast cancer.Sato T., Saito H., Swensen J., Olifant A., Wood C., Danner D., Sakamoto T., Takita K., Kasumi F., Miki Y., Skolnick M., Nakamura Y.Cancer Res. 52:1643-1646(1992)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close