Comparison

Recombinant Human PHD finger protein 11(PHF11)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP017900HU-500
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q9UIL8
Gene Names
PHF11
Organism
Homo sapiens (Human)
AA Sequence
MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLY SSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLK CKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQ SDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRG RKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDA TVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLM DETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEK KIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDL MSSSTSISSLSY
Expression Region
1-292aa
Sequence Info
Full Length of Isoform 2
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
60.5 kDa
Alternative Name
BRCA1 C-terminus-associated protein
Renal carcinoma antigen NY-REN-34
Relevance
Positive regulator of Th1-type cytokine gene expression.
Reference
"Antigens recognized by autologous antibody in patients with renal-cell carcinoma."
Scanlan M.J., Gordan J.D., Williamson B., Stockert E., Bander N.H., Jongeneel C.V., Gure A.O., Jaeger D., Jaeger E., Knuth A., Chen Y.-T., Old L.J.
Int. J. Cancer 83:456-464(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Positive regulator of Th1-type cytokine gene expression.
Subcellular Location
Nucleus
Tissue Specificity
Highly expressed in T and B-cells, as well as natural killer and mature dendritic cells. Expressed at higher levels in Th1 as compared to Th2 cells. Expressed at low levels in all normal tissues tested, including lung, testis, small intestine, breast, liver and placenta.
Amount: 500ug
Available: In stock
Listprice: €1,013.82
Price: €1,013.82
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close