Comparison

Recombinant Human Phytanoyl-CoA dioxygenase, peroxisomal(PHYH)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP017946HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Phytanic acid oxidase
Phytanoyl-CoA alpha-hydroxylase
AA Sequence
SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENG FLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTV MRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCT LPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTS RHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGC LVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYE ENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFR KAISCHFASADCHYIDVKGTSQENIEKEVVGIAHK FFGAENSVNLKDIWMFRARLVKGERTNL
Research Topic
Signal Transduction
Uniprot ID
O14832
Gene Names
PHYH
Tag Info
N-terminal GST-tagged
Expression Region
1-338aa
MW of Fusion Proten
62, 4
Sequence Info
Full Length
Relevance
Converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.
Reference
"Identification of PAHX, a Refsum disease gene."
Mihalik S.J., Morrell J.C., Kim D., Sachsteder K.A., Watkins P.A., Gould S.J.
Nat. Genet. 17:185-189(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close