Comparison

Recombinant Rat Calcium-dependent phospholipase A2(Pla2g5)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP018103RA-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Group V phospholipase A2; PLA2-10Phosphatidylcholine 2-acylhydrolase 5
AA Sequence
GLLELKSMIEKVTGKNAVKNYGFYGCYCGWGGHGT PKDGTDWCCRMHDRCYGLLEEKHCAIRTQSYDYRF TQDLVICEHDSFCPVRLCACDRKLVYCLRRNLWSY NRLYQYYPNFLC
Research Topic
Others
Uniprot ID
P51433
Gene Names
Pla2g5
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
21-137aa
MW of Fusion Proten
29, 8
Sequence Info
Full Length
Relevance
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes L-alpha-palmitoyl-2-oleoyl phosphatidylcholine more efficiently than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol.
Reference
Cloning, expression and partial characterization of a novel rat phospholipase A2.Chen J., Engle S.J., Seilhamer J.J., Tischfield J.A.Biochim. Biophys. Acta 1215:115-120(1994)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Rattus norvegicus (Rat)
Amount: 200ug
Available: In stock
Listprice: €780.22
Price: €780.22
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close