Comparison

Recombinant Mouse Putative phospholipase B-like 2(Plbd2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Liquid
Amount 500ug
Host E.coli
Item no. CSB-EP018125MO-500
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
66.3 kDa protein
76 kDa protein
AA Sequence
LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLE DGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYND SLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFE YEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQ VRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLL LQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLL PGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQ EEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVT LETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLA LDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGP SPGSRVLTILEQIPGMVVVADKTAELYKTTYWASY NIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKI FQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACN PKPNAENAISARSDLNPANGSYPFQALHQRAHGGI DVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSP FHSMLHMGQPDLWMFSPIRVPWD
Research Topic
others
Uniprot ID
Q3TCN2
Gene Names
Plbd2
Tag Info
N-terminal 6xHis-tagged
Expression Region
47-594aa
MW of Fusion Proten
65, 9
Sequence Info
Full Length of Mature Protein
Relevance
Putative phospholipase.
Reference
"Biochemical characterization and lysosomal localization of the mannose-6-phosphate protein p76 (hypothetical protein LOC196463)."
Jensen A.G., Chemali M., Chapel A., Kieffer-Jaquinod S., Jadot M., Garin J., Journet A.
Biochem. J. 402:449-458(2007)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Mus musculus (Mouse)
Amount: 500ug
Available: Out of stock
Listprice: €993.15
Price: €993.15
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Questions about this Product?
 
Close