Comparison

Recombinant Oncorhynchus mykiss Myelin proteolipid protein(plp),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP018202OEI-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
DM20Lipophilin
AA Sequence
PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDA RQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD
Research Topic
Others
Uniprot ID
P79826
Gene Names
plp
Tag Info
N-terminal 6xHis-tagged
Expression Region
150-218aa
MW of Fusion Proten
11, 7
Sequence Info
Extracellular Domain
Relevance
This is the major myelin protein from the central nervous syst. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation.
Reference
Cloning and expression of the proteolipid protein DM20 cDNA from the brain of the rainbow trout, Oncorhynchus mykiss.Tang S., Panno J.P., McKeown B.A.Brain Res. Mol. Brain Res. 41:134-139(1996)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Amount: 10ug
Available: In stock
Listprice: €246.81
Price: €246.81
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close