Comparison

Recombinant Oncorhynchus mykiss Myelin proteolipid protein(plp),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP018202OEI-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P79826
Gene Names
plp
Organism
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
AA Sequence
PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDA RQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD
Expression Region
150-218aa
Sequence Info
Extracellular Domain
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
11.7 kDa
Alternative Name
DM20Lipophilin
Relevance
This is the major myelin protein from the central nervous syst. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation.
Reference
Cloning and expression of the proteolipid protein DM20 cDNA from the brain of the rainbow trout, Oncorhynchus mykiss.Tang S., Panno J.P., McKeown B.A.Brain Res. Mol. Brain Res. 41:134-139(1996)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation.
Subcellular Location
Cell membrane, Multi-pass membrane protein
Protein Families
Myelin proteolipid protein family
Tissue Specificity
Central nervous system. Highest levels in spinal cord and medulla oblongata.
Amount: 10ug
Available: In stock
Listprice: €278.30
Price: €278.30
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close