Recombinant Human Phosphomannomutase 2(PMM2)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP018238HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
O15305
Gene Names
PMM2
Organism
Homo sapiens (Human)
AA Sequence
AAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLR QKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPEN GLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSY IAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEER IEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGG QISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKT MPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS
Expression Region
1-246aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
55 kDa
Relevance
Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.
Reference
"Mutations in PMM2, a phosphomannomutase gene on chromosome 16p13, in carbohydrate-deficient glycoprotein type I syndrome (Jaeken syndrome)."
Matthijs G., Schollen E., Pardon E., Veiga-Da-Cunha M., Jaeken J., Cassiman J.-J., van Schaftingen E.
Nat. Genet. 16:88-92(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close